Index 
Search
Download
Help
UNK_00415: Duo1p-interacting protein
ID:

UNK_00415
AC:

415
CL:

UNK
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Duo1p-interacting protein
GN:

DAM1
DIF1
G6153
YGR113W
OS:

Homo sapiens (Human)
P1:

9817759 (1998)
P2:

9817759 (1998)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

343 AA; 38427 Da; calculated pI: 9.20
SQ:

MSEDKAKLGTTRSATEYRLSIGSAPTSRRSSMGESSSLMKFADQEGLTSSVGEYNENTIQ
QLLLPKIRELSDSIITLDSNFTRLNFIHESLADLNESLGSLLYGIMSNSWCVEFSQAPHD
IQDDLIAIKQLKSLEDEKNNLVMELSNMERGIKRKKDEQGENDLAKASQNKQFNQPLFPS
SQVRKYRSYDNRDKRKPSKIGNNLQVENEEDYEDDTSSEASFVLNPTNIGMSKSSQGHVT
KTTRLNNNTNSKLRRKSILHTIRNSIASGADLPIENDNVVNLGDLHPNNRISLGSGAARV
VNGPVTKNRNSMFSGRAERKPTESRHSVAKKTEKKINTRPPFR

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab