Index 
Search
Download
Help
UNK_00413: Poly (ADP-ribose) glycohydrolase
ID:

UNK_00413
AC:

413
CL:

UNK
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Poly (ADP-ribose) glycohydrolase
GN:

Parg
OS:

Homo sapiens (Human)
P1:

10331632 (1999)
P2:

10331632 (1999)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

972 AA; 108995 Da; calculated pI: 6.51
SQ:

MSAGPGCEPCTKRPRWGAAGTSAPTASDSRSFPGRQKRVLDPKDAPVQFRVPPSSSACVS
GRAGPHRGSVTSFVFKQKPITTWMDTKGPKTAESESKENNNTRTDPMMSSVQKDNFYPHK
VEKLGNVPQLNLDKSPTEKSTPYLNQQQTAGVCKWHSAGERAEQLSASEPSAVTQAPKQL
SNANIDQSPPTDGHSDTDHEEDRDNQQFLTPVKLANAKQTVGDGQARSNCKCSASCQCGQ
DCAGCQREEADVIPESPLSDVGAEDIGTGSKNDNKLTGQESGLGDSPPFEKESEPESPMD
VDNSKTSCQDSEADEEASPVFDEQDDQDDRSSQTANKLSSRQAREVDGDLRKRYLTKGSE
IRLHFQFEGGSNAGTSDLNAKPSGNSSSLNVDGRSSKQHGKRDSKITDHFVRIPKSEDKR
KEQCEVRHQRAERKIPKYVPPNLPPDKKWLGTPIEEMRKMPRCGVRLPLLRPSASHTVTV
RVDLLRAGEVPKPFPTHYKDLWDNKHVKMPCSEQNLYPVEDENGERTAGSRWELIQTALL
NKFTRPQNLKDAILKYNVAYSKKWDFTALVDFWDKVLEEAEAQHLYQSILPDMVKIALCL
PNICTQPIPLLKQKMNHSVTMSQEQIASLLANAFFCTFPRRNAKMKSEYSSYPDINFNRL
FEGRSSRKPEKLKTLFCYFRRVTEKKPTGLVTFTRQSLEDFPEWERCDKPLTRLHVTYEG
TIEGNGRGMLQVDFANRFVGGGVTGAGLVQEEIRFLINPELIVSRLFTEVLDHNECLIIT
GTEQYSEYTGYAETYRWARSHEDGSEKDDWQRCCTEIVAIDALHFRRYLDQFVPEKVRRE
LNKAYCGFLRPGVPPENLSAVATGNWGCGAFGGDARLKALIQLLAAAAAERDVVYFTFGD
SELMRDIYSMHTFLTERKLNVGKVYRLLLRYYREECRDCSSPGPDTKLYPFIYHAAESSA
ETSDQPGQRTGT

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab