Index 
Search
Download
Help
UNK_00406: Stella
ID:

UNK_00406
AC:

406
CL:

UNK
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Stella
GN:

Dppa3
PCG7
Stella
2410075G02Rik
OS:

Homo sapiens (Human)
P1:

12124616 (2002)
P2:

12124616 (2002)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

150 AA; 17679 Da; calculated pI: 9.67
SQ:

MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLR
NRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEF
ERDSEPFRCLCTFCHYQRWDPSENAKIGKN

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab