Index 
Search
Download
Help
UNK_00404: Zinc finger protein 278
ID:

UNK_00404
AC:

404
CL:

UNK
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Zinc finger protein 278
GN:

ZNF278
DJ400N23
MAZR
PATZ
ZSG
RIAZ
dJ400N23
OS:

Homo sapiens (Human)
P1:

10713105 (2000)
P2:

10713105 (2000)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SS:

GenBank
SI:

687 AA; 74072 Da; calculated pI: 8.71
SQ:

MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLA
ACSEYFESVFSAQLGDGGAADGGPADVGGATAAPGGGAGGSRELEMHTISSKVFGDILDF
AYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGT
SDLGFPLDMTNGAALAANSNGIAGSMQPEEEAARAAGAAIAGQASLPVLPGVDRLPMVAG
PLSPQLLTSPFPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKV
FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEIC
GKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK
GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
YMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPILNGGAAFH
CARTYGNKEGQKCSHQDPIESSDSYGDLSDASDLKTPEKQSANGSFSCDMAVPKNKMESD
GEKKYPCPECGSFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFG
FQIVQSAFASSLVDPEVDQQPMGPEGK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab