Index 
Search
Download
Help
UNK_00394: SPT23 protein
ID:

UNK_00394
AC:

394
CL:

UNK
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

SPT23 protein
GN:

SPT23
YKL020C
OS:

Saccharomyces cerevisiae (Baker's yeast)
P1:

11598205 (2001)
P2:

11598205 (2001)
CC:

protein found in www.incyte.com-database
SP:

SP23_YEAST, P35210
SS:

SWISSPROT/TrEMBL
SI:

1082 AA; 121202 Da; calculated pI: 6.22
SQ:

MMSGTGNVSSMLHSYSANIQHNDGSPDLDLLESELLDIALLNSGSSLQDPGLLSLNQEKM
ITAGTTTPGKEDEGELRDDIASLQGLLDRHVQFGRKLPLRTPYANPLDFININPQSLPLS
LEIIGLPKVSRVETQMKLSFRIRNAHARKNFFIHLPSDCIAKDKFFTSSDDPTNLTIPNR
DINERTLFLDAFLLCASNNNSNNFKQTYVCNRCINREKRRASRRKSGLNDNSIWQNNENK
RAIIFNSKQLFIISNNGLSGNSNCINFDLPTRIVCYCRHHKATNGFVVLFLLRDHNGDIL
AKTITDPIMIMDKKNASNTTTPTSTSNAQVSPMTNDTRSFSSPQSDLNFPSEFPLPSNSK
NFVISTNCMLDSNCNNNNNDNDNKNNIKTNTAMMNNNRHFPSPNSSSEDSNHSFSDIHFS
NNNDNNLHRSLDSWSSTGFNSSSNPALTTLTSDFSAASARHTGKRQRSVNEPFMSTPNTF
SRLPQKFIDSSKDISNHNSVPVALNNKPSIQRVIPAQGSINGGIEVTLLGSKFKQGLIIK
FGENIALSSQCWNESTMVTYLPPSSKPGPVLVTIVDPSETSMRNNSNSSVSTSNSTNDIL
HLNKYTGEKAIFTYVDDTDRQLIELALQIVGLKMNGKLEDARNIAKRIVGSDSSPSNNNA
GLHSQNSSLNSYTNMMRNINDEQLITEVIKSFKRNNNLSTVNLSMCDVRGRTLLHLAAFN
NWYSLVSLLIKYGSHLNDQDLFGFTPLHMACINGDLRIIRLLLECNVNIMKKTRNGFIAK
QFFLMNYTVNKTRYSNYETSLFDDILTRLTKNTTGSSDTQPFERNVSQSSFNSSLFDDDD
ADHDYVQERKYLLADSAALAPEQSNCNDNTSFSILDSDSGYDISDCESSSDEIALEFFNT
HKIKDFSSKPNEIPKTTKTSIEPDGSLWNRMLTRLNDELPKYEDLFPKKPKNWELGSKSV
EIGPDNSAQMTVDDSQTSSEDDELEALQVGFNTIFSKKQNFQNDKMLLFFWIPLTLVLLL
CFTLSNLGKDDDMFHNLSKIVQEYLRIGLAKVLLGNERMKTSFKMQLSKFQNNNILNDMR
VN

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab