Index 
Search
Download
Help
UNK_00393: Ubiquitin-like protein SMT3 [Precursor]
ID:

UNK_00393
AC:

393
CL:

UNK
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Ubiquitin-like protein SMT3 [Precursor]
GN:

SMT3
YDR510W
D9719.15
OS:

Saccharomyces cerevisiae (Baker's yeast)
P1:

10364461 (1999)
P2:

10364461 (1999)
CC:

protein found in www.incyte.com-database
SP:

SMT3_YEAST, Q12306
PD:

1EUV, 1L2N
SS:

SWISSPROT/TrEMBL
SI:

101 AA; 11584 Da; calculated pI: 4.92
SQ:

MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEM
DSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab