Index 
Search
Download
Help
UNK_00390: MGA2 protein
ID:

UNK_00390
AC:

390
CL:

UNK
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

MGA2 protein
GN:

MGA2
YIR033W
OS:

Saccharomyces cerevisiae (Baker's yeast)
P1:

11598205 (2001)
P2:

11598205 (2001)
CC:

protein found in www.incyte.com-database
SP:

MGA2_YEAST, P40578
SS:

SWISSPROT/TrEMBL
SI:

1113 AA; 126913 Da; calculated pI: 5.02
SQ:

MQQNSEFLTETPGSDPHISQLHANSVMESQLLDDFLLNGSPMYQDDSMAHINIDEGANFQ
NFIKTDEGDSPNLLSFEGIGNNTHVNQNVSTPLEEEMESNRALKEEEEDEHENKVFNEKN
IGNPAHDEIVFGRKETIQSVYINPLDYLKVNAAQLPLDVEVSGLPQVSRVENQLKLKVKI
TSETPLNQSMLYLPSDSISREKFYLKKNIEDFSEDFKKNLLYINAFVLCAVSNRTTNVCT
KCVKREQRRAARRKSGIADNLLWCNNINRRLVVFNNKQVFPIMKTFDNVKEFELTTRLVC
YCRHHKANNGFVILFTITDWQNRLLGKFTTTPIMITDRKPANMDTTKFNNTTTSSRRQLT
EEESTTEYYSTDNNQLSKDENMPFQYTYQHNPYDNDSQMNNIPLKDKNVPFPYSISQQTD
LLQNNNLSLNLSLPNQHIPSPTSMSEEGSESFNYHHRDNDNPVRTISLTNIEQQSQLNQR
KRARNNLENDIGKPLFKHSFSNSISATNTMNPALHSMQDFSMKNNNNNLPSINRVIPSQG
PINGGIEVTLLGCNFKDGLSVKFGSNLALSTQCWSETTIVTYLPPAAYAGQVFVSITDTN
NENNNDDLPQEIEINDNKKAIFTYVDDTDRQLIELALQIVGLKMNGKLEDARNIAKRIVG
NDSPDSGTNGNSCSKSTGPSPNQHSMNLNTSVLYSDEVLIQKVIKSLNINSNISICDSLG
RTLLHLACLKNYSSLVYTLIKKGARVNDIDSFGLTPLHFACISGDPKIIKMLLNCKVNYS
LRSHNGLTAREVFIANHIHSKEIDKKQDNRDNHKFVHNDTYISEVLSLFEEFQNGTKFTD
SVETDSNYSISRKYSQSSFNSSLLDNESLNENLFESQSMINPTSMEIQHPTLQLFENSSY
SEYDQSDFEEDGDEDLFVTDEVEKPGVACREEQSELLDIGSSANEPEEDNGSTSLWNRVL
HRINDDLPKYEDLFPLSWGKDDKLKTTNQDSIVEQSASNIENSENSEEEDYEEEEEFLKK
QFNRFFQNKQNFRNDKMLIFFWIPLTLLLLTWFIMYKFGNQDSSINHISELISEYLRIAL
AKFLLGNERMKTAFRSKLSNLQTTRMLNDLIVS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab