Index 
Search
Download
Help
UNK_00377: T-complex protein 1, gamma subunit
ID:

UNK_00377
AC:

377
CL:

UNK
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

T-complex protein 1, gamma subunit
TCP-1-gamma
CCT-gamma
Matricin
GN:

CCT3
CCTG
OS:

Mus musculus (Mouse)
P1:

7890169 (1995)
P2:

7890169 (1995)
CC:

protein found in www.incyte.com-database
SP:

TCPG_MOUSE, P80318
PD:

1GML, 1GN1
SS:

SWISSPROT/TrEMBL
SI:

545 AA; 60560 Da; calculated pI: 6.28
SQ:

MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMT
NDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPT
VVISAYRMALDDMISTLKKISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAV
KTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVL
LDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLA
QHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYF
TFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH
ALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETWGV
NGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQNRQTGAP
DAGQE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab