Index 
Search
Download
Help
UNK_00368: Chromatin assembly factor 1 subunit C
ID:

UNK_00368
AC:

368
CL:

UNK
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Chromatin assembly factor 1 subunit C
CAF-1 subunit C
Chromatin assembly factor I p48 subunit
CAF-I 48 kDa subunit
CAF-Ip48
Retinoblastoma binding protein p48
Retinoblastoma-binding protein 4
RBBP-4
MSI1 protein homolog
GN:

RBBP4
RBAP48
OS:

Homo sapiens (Human)
P1:

10404385 (1999)
P2:

10404385 (1999)
CC:

protein found in www.incyte.com-database
SP:

RBB4_HUMAN, Q09028
SS:

SWISSPROT/TrEMBL
SI:

425 AA; 47603 Da; calculated pI: 4.74
SQ:

MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD
FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG
YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE
SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE
DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab