Index 
Search
Download
Help
UNK_00360: RNA-binding protein EWS
ID:

UNK_00360
AC:

360
CL:

UNK
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

RNA-binding protein EWS
EWS oncogene
Ewing sarcoma breakpoint region 1 protein
GN:

EWSR1
EWS
OS:

Homo sapiens (Human)
P1:

9341188 (1997)
P2:

9341188 (1997)
CC:

protein found in www.incyte.com-database
SP:

EWS_HUMAN, Q01844
SS:

SWISSPROT/TrEMBL
SI:

656 AA; 68404 Da; calculated pI: 9.37
SQ:

MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTAT
YGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGT
QPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP
MQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY
PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNR
GRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDN
SAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDP
PTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGP
GGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTEC
NQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFR
GGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab