Index 
Search
Download
Help
NUS_00414: Thymopoietin
ID:

NUS_00414
AC:

414
CL:

NUS
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Thymopoietin
GN:

Tmpo
Rn.3364
LAP2
OS:

Homo sapiens (Human)
P1:

9707448 (1998)
P2:

9707448 (1998)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

452 AA; 50287 Da; calculated pI: 9.40
SQ:

MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSK
GPPDFSSDEEREPTPVLGSGASVGRGRGAVGRKATKKTDKPRPEDKDDLDVTELSNEELL
EQLVRYGVNPGPIVGTTRKLYEKKLLKLREQGAESRSSTPLPTVSSSAENTRQNGSNDSD
RYSDNDEDSKIELKLEKREPLKGRAKTPVTLKQRRIEHNQSYSEAGVTETEWTSGSSKGG
PLQALTRESTRGSRRTPRRRVEPSQHFRVDGAVISESTPIAETIKASSNDSLVANRLTGN
FKHASSILPITEFSDITRRTPKKPLTRAEVGEKTEERRVERDILKEMFPYEASTPTGISA
SCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSVPMWIKMLLFA
LVAGFLFLVYQAMETNQGNPFTNFLQDTKISN

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab