Index 
Search
Download
Help
NUS_00395: High affinity DNA-binding factor subunit 1
ID:

NUS_00395
AC:

395
CL:

NUS
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

High affinity DNA-binding factor subunit 1
Ku70 homolog
GN:

HDF1
NES24
YKU70
YMR284W
YM8021.10
OS:

Saccharomyces cerevisiae (Baker's yeast)
P1:

10638763 (2000)
P2:

10638763 (2000)
CC:

protein found in www.incyte.com-database
SP:

HDF1_YEAST, P32807
SS:

SWISSPROT/TrEMBL
SI:

602 AA; 70567 Da; calculated pI: 6.01
SQ:

MRSVTNAFGNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILE
SLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSS
GRISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEA
QDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEF
DGPSTKPIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYK
LVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKD
AFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGK
LKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKV
TQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDD
SLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISIKEEKKPFDKKPKF
NI

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab