Index 
Search
Download
Help
NUS_00392: Hypothetical 195.1 kDa protein in DNA43-UBI1 intergenic region
ID:

NUS_00392
AC:

392
CL:

NUS
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Hypothetical 195.1 kDa protein in DNA43-UBI1 intergenic region
GN:

YIL149C
OS:

Saccharomyces cerevisiae (Baker's yeast)
P1:

10638763 (2000)
P2:

10638763 (2000)
CC:

protein found in www.incyte.com-database
SP:

YIO9_YEAST, P40457
SS:

SWISSPROT/TrEMBL
SI:

1679 AA; 194921 Da; calculated pI: 5.80
SQ:

MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRIS
KLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKR
VKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQE
KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ
NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE
KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTV
GKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRST
ELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETAS
PLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKL
ENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENK
ANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFE
NFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEI
SKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKI
KELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTI
EKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEE
IISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKE
GALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIR
LEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSV
LIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTIN
DLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQ
LNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEK
LTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDK
LEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTANS
SSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEY
EDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLTFLDNKG
SGEDAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVTNKEN
NIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQPEVA
VKAAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSSDPDTKKVKESPANDQASNE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab