Index 
Search
Download
Help
NUS_00384: Nuclear migration and anchoring protein unc-84
ID:

NUS_00384
AC:

384
CL:

NUS
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Nuclear migration and anchoring protein unc-84
Uncoordinated protein 84
GN:

UNC-84
F54B11.3
OS:

Caenorhabditis elegans
P1:

10375507 (1999)
P2:

10375507 (1999)
CC:

protein found in www.incyte.com-database
SP:

UN84_CAEEL, Q20745
SS:

SWISSPROT/TrEMBL
SI:

1111 AA; 125718 Da; calculated pI: 8.75
SQ:

MAPATEADNNFDTHEWKSEFASTRSGRNSPNIFAKVRRKLLLTPPVRNARSPRLTEEELD
ALTGDLPYATNYTYAYSKIYDPSLPDHWEVPNLGGTTSGSLSEQEHWSAASLSRQLLYIL
RFPVYLVLHVITYILEAFYHVIKITSFTIWDYLLYLVKLAKTRYYAYQDHRRRTALIRNR
QEPFSTKAARSIRRFFEILVYVVLTPYRMLTRSNNGVEQYQYRSIKDQLENERASRMTTR
SQTLERSRKFDGLSKSPARRAAPAFVKTSTITRITAKVFSSSPFGEGTSENITPTVVTTR
TVKQRSVTPRFRQTRATREAITRALDTPELEIDTPLSTYGLRSRGLSHLNTPEPTFDIGH
AAATSTPLFPQETYNYQYEEATGNKIKTAFTWLGYLILFPFFAARHVWYTFYDYGKSAYM
KLTNYQQAPMETIHVRDINEPAPSSSDVHDAVGVSWRIRIADFLSSFVATIVEAHQVVFA
MFKGGIVETVSYFGGLFAGLTDKKSSKFSWCQILGLLLALLFAIFLLGFLTSDNTAIRVK
EITKDKNASKKSEGSLPAVPIWISAANHVKHYTWMVKEFVVDIAFDTYNYGKSTIGRLGT
TPRYAWDLIASGCGAVGNGLKSVLSSSFRFIDFCAGKLFYYGSDGFLSANKSIGTFFNGC
YETLYNGCTAIVGHTKSFIYNASNAVYNFFSTIFAGLLNFSTSSQNSILSLLKSFGTGIT
NIFYNFIYAPIAGVFNFAGDNYMYFFNEVAAVFGKVYNSVVSVLKTVINWILFLIAYPFS
LCTRAWIRISQYAPEDVVQVIPIPQAITPTPDVERIVEEPLRKVTDVEDEELVIIPAPAP
KPIPVPAPTPAPVIIHQTNVVETVDKDAIIKEVTEKLRAELSAQFQQELSAKFEQNYNTI
IEQLKMENTNIQYDKNHLEAIIRQMIYEYDTDKTGKVDYALESSGGAVVSTRCSETYKSY
TRLEKFWDIPIYYFHYSPRVVIQRNSKSLFPGECWCFKESRGYIAVELSHFIDVSSISYE
HIGSEVAPEGNRSSAPKGVLVWAYKQIDDLNSRVLIGDYTYDLDGPPLQFFLAKHKPDFP
VKFVELEVTSNYGAPFTCLYRLRVHGKVVQV

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab