Index 
Search
Download
Help
NUS_00383: ran-1
ID:

NUS_00383
AC:

383
CL:

NUS
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

ran-1
K01G5.4 protein
GN:

K01G5.4
Ran
OS:

Caenorhabditis elegans
P1:

11909538 (2002)
P2:

11909538 (2002)
CC:

protein found in www.incyte.com-database
SP:

SP10_MOUSE, O17915
SS:

SWISSPROT/TrEMBL
SI:

215 AA; 24226 Da; calculated pI: 6.96
SQ:

MSGGDGIPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQIRF
NVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTARVTYKNVPNWHRDLARVCENIPIVLCG
NKVDVKDRKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLLGDPNLEFVAMPA
LAPPEVQMDPAMIAEYEKDLDNAAKADLPDDDDDL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab