Index 
Search
Download
Help
NUS_00170: Nucleolin
ID:

NUS_00170
AC:

170
CL:

NUS
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Nucleolin
Protein C23
GN:

NCL
OS:

Homo sapiens (Human)
CT:

erythroleukemia K562 cell
P1:

7799955 (1995)
P2:

7799955 (1995)
SP:

NUCL_HUMAN, P19338
SS:

SWISSPROT/TrEMBL
SI:

706 AA; 76130 Da; calculated pI: 4.59
SQ:

VKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSA
KKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVAT
PGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAA
PASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEED
DEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGT
EPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLE
KALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRL
VSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTW
SGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALN
SCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIV
TDRETGSSKGFGFVDFNSEEDAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFG
GRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab