Index 
Search
Download
Help
NUM_00405: Intranuclear matrix protein
ID:

NUM_00405
AC:

405
CL:

NUM
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Intranuclear matrix protein
GN:

Cep2
Inmp
Mm.4786
OS:

Homo sapiens (Human)
P1:

8950169 (1996)
P2:

8950169 (1996)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

446 AA; 50136 Da; calculated pI: 5.27
SQ:

MRQKQDPAGQLAAGQATLTEQEQELAALRAENQYSRRQEEAAVSQAEALQEALSKAQAAL
QEKEQSLLEQAELSHTLEASTAALQATLDTCQARARQLEEALRIREGEIQAQALQHHEVT
QHLQQELCQKEEELRQLLEKAGARRSQENGIQEKQSLEQERQEETRRLLESLKELQLTVA
QREEEILMLREASSPSHRALPAEKPALQPLPAQQELERLQTALRQTEAREIEWREKAQDL
ALSLAQSKASISSLQEITMFLQASVLERESEQQRLQEELVLSSQALEEQQSGGPHSTSRA
DQGPKVGQESQPGEVETEPSPGVEEKERLTQRLERLQQAVAELEVDRSKLQCHNAQLRTA
LEQVERERRKLKRDSVRASRAGSLEARETMTSSPTQQDGRGSQRGSSDSVLVVELQREVA
LLRAQLALERKRGRTTLHGPCRPAVS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab