Index 
Search
Download
Help
NUM_00388: Lamin B1
ID:

NUM_00388
AC:

388
CL:

NUM
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Lamin B1
GN:

LMNB1
OS:

Rattus norvegicus (Rat)
P1:

1525831 (1992)
P2:

1525831 (1992), 12898336 (2003)
CC:

protein found in www.incyte.com-database
SP:

LAM1_RAT, P70615
SS:

SWISSPROT/TrEMBL
SI:

586 AA; 66401 Da; calculated pI: 5.16
SQ:

ATATPVQQRAGSRASAPATPFSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQ
LQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKFKAEHDQLLLNY
AKKESDLSGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLSAAK
KQLADETLLKVDLENRCQSLTEDLEFRKNMYEEEINETRRKHETRLVEVDSGRQIEYEYK
LAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSARGGMMESRMRIE
SLSSQLSNLQKDSRACLERIQELEDMLAKERDNSRRMLSDKEREMAEIRDQMQQQLNDYE
QLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDV
EESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVS
YKYTSRYVLKAGQTVTVWAANAGVTASPPTDLIWKNQNSWGTGEDVKVVLKNSQGEEVAQ
RSTVFKTTIPEEEEEEEEEPIGVPLEEERFHQQGTPRASNKSCAIM

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab