Index 
Search
Download
Help
NUM_00321: Matrin 3
ID:

NUM_00321
AC:

321
CL:

NUM
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Matrin 3
GN:

MATR3
OS:

Rattus norvegicus (Rat)
CT:

paper states highly acidic C-terminal domain to be responsible for interactions with other NM-proteins
P1:

2033075 (1991), 1946450 (1991), 9178570 (1997)
P2:

1946450 (1991), 2033075 (1991), 8670298 (1996), 9178570 (1997), 12469345 (2002), 11525732 (2001)
SP:

MAT3_RAT, P43244
SS:

SWISSPROT/TrEMBL
SI:

845 AA; 94342 Da; calculated pI: 5.82
SQ:

MSKSFQQSSLGRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGM
SSSLNQQGAHSALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDTDQASNILASFGLSAR
DLDELSRYPEDKITPENLPQILLQLKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEE
KRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRLRDGERCRDDSFFGETS
HNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIEDFHGLLPKGYPHLCSICDLPV
HSNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFMLQQSTNPAPGILGPPP
PSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVE
PFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKP
EGKPDEKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEME
TREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPD
GKESPSDKKSKTDGAQKTENPAEGKEQEEKSGEDGEKDTKDDQTEQEPSMLLESEDELLV
DEEEAAALIESGSSVGDETDLANLGDVSSDGKKEPSDKAVKKDASATSKKKLKKVDKIEE
LDQENEAALENGIKNEENTEPGAESAENADDPNKDASDNSDGQNDENKEDYTIPDEYRIG
PYQPNVPGGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEERR
QKKES

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab