Index 
Search
Download
Help
NUM_00296: Runt-related transcription factor 2
ID:

NUM_00296
AC:

296
CL:

NUM
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Runt-related transcription factor 2
Core-binding factor, alpha 1 subunit
CBF-alpha 1
Acute myeloid leukemia 3 protein
Oncogene AML-3
Polyomavirus enhancer binding protein 2 alpha A subunit
PEBP2-alpha A
PEA2-alpha A
SL3-3 enhancer factor 1 alpha A subunit
SL3/AKV core-binding factor alpha A subunit
Osteoblast-specific transcription factor 2
OSF-2
GN:

RUNX2
CBFA1
AML3
PEBP2A
OSF2
OS:

Homo sapiens (Human)
CT:

osteoblast
P1:

11135373 (2001), 10559245 (1999)
P2:

9495508 (1998), 12391164 (2002), 12067068 (2001), 11135373 (2001), 10559245 (1999)
SP:

RUN2_HUMAN, Q13950
SS:

SWISSPROT/TrEMBL
SI:

521 AA; 56585 Da; calculated pI: 9.03
SQ:

MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQ
QQQQQQQQQQQEAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPN
FLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVA
RFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPS
LFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYD
QSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKS
QAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHT
YLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGS
TLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab