Index 
Search
Download
Help
NUM_00274: DNA-binding protein SATB1
ID:

NUM_00274
AC:

274
CL:

NUM
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

DNA-binding protein SATB1
Special AT-rich sequence binding protein 1
GN:

SATB1
OS:

Homo sapiens (Human)
CT:

erythroleukemia K562 cell
P1:

8049444 (1994), 14605447 (2003), 12915443 (2003)
P2:

7559473 (1995), 8049444 (1994), 8575883 (1995), 10800076 (2000), 14605447 (2003), 12915443 (2003)
SP:

SAT1_HUMAN, Q01826
SS:

SWISSPROT/TrEMBL
SI:

763 AA; 85860 Da; calculated pI: 6.10
SQ:

MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHS
GHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY
SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLP
PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY
KHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL
PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP
LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ
SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIA
TERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSP
ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQ
QQQQQQQAPPPPQPQQQPQTGPRLPPRQPTVASPAESDEENRQKTRPRTKISVEALGILQ
SFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLKDNSGLEVDVAEYK
EEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab