Index 
Search
Download
Help
NUM_00190: Lamin A/C
ID:

NUM_00190
AC:

190
CL:

NUM
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Lamin A/C
70 kDa lamin
GN:

LMNA
LMN1
CT:

limbal epithelial cell
P1:

11862099 (2002)
P2:

11862099 (2002)
CC:

sequence taken from human
SP:

LAMA_HUMAN, P02545
PD:

1IFR, 1IVT
SS:

SWISSPROT/TrEMBL
SI:

664 AA; 74057 Da; calculated pI: 6.57
SQ:

METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR
LRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARN
TKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESR
LADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID
SLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRK
LESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLT
YRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASA
SGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQN
CSIM

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab