Index 
Search
Download
Help
NUM_00171: Peptidylprolyl isomerase matrin CYP
ID:

NUM_00171
AC:

171
CL:

NUM
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Peptidylprolyl isomerase matrin CYP
Peptidylprolyl cis-trans isomerase
Matrin cyclophilin
Matrin CYP
PPIase
GN:

MATRIN-CYP
P1:

9525923 (1998)
P2:

9525923 (1998)
CC:

sequence taken from rat
SP:

O55035
SS:

SWISSPROT/TrEMBL
SI:

752 AA; 87975 Da; calculated pI: 10.28
SQ:

MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHY
KSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTN
GSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELVPK
SKVKKEEKKRHKSSSSSSSSDSDSSSDSQSSSDSSDSETASEEKSRKRKKKHRKNSRKHK
KEKKKRKKSKKSPSSESEADNVDAQPQSTVRPEEIPPIPENRFLMRKSPPKADDKERKNR
ERERERECNPPNSQPASYQRRFLVTRSGRKIKGRGPRRYRTPSRSRSRDRFRRSETPPHW
RQEMQRAQRMRVSSGERWIKGDKSELNEIKENQRSPVRVKEKKITDHRHMSESPNRGIEK
GGKVKDHKLESKERDIRRNSGKDDKYNKNKVKKRGKSKSRSKSKERSKSKERDSKHSRHE
DKRVRSRSKERDHETTKEKEKQLDSKGKDQERSRSKENSKQVESKSNEHDHSKSKEKDRR
AQSRSRERDLTKSKHSYNSRTRERSRSRDRSRRVRSRSHDRDRSRSKEYHRYREQEYRRR
GRSRSRDRRTPGRSRSKDRRRRRRDSRSSEREESQSRNKEKYRSQDSKSSHRKENSEGEK
RMYSKSRDHSSSNNNREKKADIDQSPVSKTKQSSQDNEVKSSTLKNQEDEKTRSPVEKEN
QKSKGQENDHVHDKNKKCDHESSPGTDEDKSG

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab