Index 
Search
Download
Help
NUM_00129: MYB binding Protein p160
ID:

NUM_00129
AC:

129
CL:

NUM
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

MYB binding Protein p160
OS:

Mus musculus (Mouse)
P1:

1397079 (1992)
P2:

1397079 (1992)
SS:

GenBank
SI:

1344 AA; 151862 Da; calculated pI: 9.08
SQ:

MAEMKSPTKAEPATPAEAAQSDRHSLLEHSREFLDFFWDIAKPDQETRLRATEKLLEYLR
TRPNDSEMKYALKRLITGLGVGREAARPCYSLALAQLLQSFEDIPLCDILDQIQEKYSLQ
AMNKAMMRPSLFANLFGVLALFQSGRLVKDKEALMKSVQLLKILSQHPNHLQGQPIKALV
DILSEVPESMFQEILPKVLKGNMKVILRSPKYLELFLLAKQRVPTKLESLMGSVDLFSED
NIPSLVNILKVAANSVKKEHKLPNVALDLLRLALKESRFELFWKKVLEEGLLKNPSWTSS
YMCFRLLGASLPLLSEEQLQLVMRGDLIRHFGENMVISKPQNLFKIIPEISTYVGTFLEG
CQDDPKRQLTMMVAFTTITNQGLPVMPTFWRVTRFLNAEALQSYVAWLRDMFLQPDLNSL
VDFSTANQKRAQDASLNVPERAVFRLRKWIIHRLVSLVDHLHLEKDEAVVEQIARFCLFH
AFFKTKKATPQIPETKQHFSFPLDDRNRGVFVSAFFSLLQTLSVKFRQTPDLAENGKPWT
YRLVQLADMLLNHNRNVTSVTSLTTQQRQAWDQMMSTLKELEARSSETRAIAFQHLLLLV
GLHIFKSPAESCDVLGDIQTCIKKSMEQNPRRSRSRAKASQEPVWVEVMVEILLSLLAQP
SNLMRQVVRSVFGHICPHLTPRCLQLILAVLSPVTNEDEDDNVVVTDDADEKQLQHGEDE
DSDNEDNKNSESDMDSEDGEESEEEDRDKDVDPGFRQQLMEVLKAGNALGGVDNEEEEEL
GDEAMMALDQNLASLFKEQKMRIQARNEEKNKLQKEKKLRRDFQIRALDLIEVLVTKQPE
HPLILELLEPLLNVIQHSMRSKGSTKQEQDLLHKTARIFMHHLCRARRYCHEVGPCAEAL
HAQVERLVQQAGSQADASVALYYFNASLYLLRVLKGNTNKRHQDGHKLHGADTEDSEDQA
ANCLDLDFVTRVYSASLESLLTKRNSSLTVPMFLSLFSRYPVICKNLLPVLAQHVAGPSR
PRHQAQACLMLQKTLSARELRVCFEDPEWEQLITQLLGKATQTLQTLGEAQSKGEHQKEL
SILELLNTLLRTVNHEKLSVDLTAPLGVLQSKQQKLQQSLQQGNHSSGSNRLYDLYWQAM
RMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ
DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNPTLSPSTPAKT
PKLQKKKEKLSQVNGATPVSPIEPESKKHHQEALSTKEVIRKSPHPQSALPKKRARLSLV
SRSPSLLQSGVKKRRVASRRVQTP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab