Index 
Search
Download
Help
NUM_00125: RuvB-like 1
ID:

NUM_00125
AC:

125
CL:

NUM
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

RuvB-like 1
49-kDa TATA box-binding protein-interacting protein
49 kDa TBP-interacting protein
TIP49a
Pontin 52
Nuclear matrix protein 238
NMP 238
54 kDa erythrocyte cytosolic protein
ECP-54
TIP60-associated protein 54-alpha
TAP54-alpha
GN:

RUVBL1
TIP49
TIP49A
NMP238
OS:

Homo sapiens (Human)
P1:

9813143 (1998)
P2:

9813143 (1998)
SP:

RUV1_HUMAN, Q9Y265
SS:

SWISSPROT/TrEMBL
SI:

456 AA; 50170 Da; calculated pI: 6.02
SQ:

MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKK
MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAI
GLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESL
QKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTL
HDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLF
VDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMI
IRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab