Index 
Search
Download
Help
NUM_00122: Charged multivesicular body protein 1/chromatin modifying protein 1
ID:

NUM_00122
AC:

122
CL:

NUM
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Charged multivesicular body protein 1/chromatin modifying protein 1
OS:

Homo sapiens (Human)
CT:

various
P1:

11559747 (2001)
P2:

11559747 (2001)
SP:

Q9HD42
SS:

SWISSPROT/TrEMBL
SI:

196 AA; 21678 Da; calculated pI: 7.77
SQ:

MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGV
NWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQ
NLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSV
RSQEDQLSRRLAALRN

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab