Index 
Search
Download
Help
NUM_00052: Nuclear protein Hcc-1
ID:

NUM_00052
AC:

52
CL:

NUM
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Nuclear protein Hcc-1
HSPC316
Proliferation associated cytokine-inducible protein CIP29
GN:

HCC1
OS:

Homo sapiens (Human)
CT:

liver cancer cell
P1:

9413206 (1997)
P2:

9413206 (1997)
SP:

HCC1_HUMAN, P82979
SS:

SWISSPROT/TrEMBL
SI:

210 AA; 23644 Da; calculated pI: 6.10
SQ:

MATETVELHKLKLAELKQECLARGLETKGIKQDLIHRLQAYLEEHAEEEANEEDVLGDET
EEEETKPIELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKK
AARAARFGISSVPTKGLSSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKER
FGIVTSSAGTGTTEDTEAKKRKRAERFGIA

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab