Index 
Search
Download
Help
NUM_00022: Ectoderm-neural cortex-1 protein
ID:

NUM_00022
AC:

22
CL:

NUM
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Ectoderm-neural cortex-1 protein
ENC-1
P53-induced protein 10
Nuclear matrix protein NRP/B
GN:

ENC1
PIG10
NRPB
OS:

Homo sapiens (Human)
CT:

primary hipocampal neuron
P1:

9566959 (1998)
P2:

9566959 (1998), 10974570 (2000)
SP:

ENC1_HUMAN, O14682
SS:

SWISSPROT/TrEMBL
SI:

589 AA; 66054 Da; calculated pI: 6.40
SQ:

MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCH
RAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRVIINEENAESL
LEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIR
KNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISYDLKKRYCYLPELLQTVRLAL
LPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLL
GGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAIGCKVYITGGRGSENGVSKDVWV
YDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPT
INKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQ
PWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKL
YVVGGYFGIQRCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab