Index 
Search
Download
Help
NUM_00020: C1D protein
ID:

NUM_00020
AC:

20
CL:

NUM
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

C1D protein
GN:

C1D
OS:

mammalian
P1:

11801738 (2002)
P2:

12421302 (2002), 11801738 (2002)
CC:

sequence taken from mouse
SP:

Q61368
SS:

SWISSPROT/TrEMBL
SI:

141 AA; 16026 Da; calculated pI: 9.35
SQ:

MAGEEMNEDYPVEIHESLTALESSLGAVDDMLKTMMAVSRNELLQKLDPLEQAKVDLVSA
YTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAAKLDRGAASRFVKK
ALWEPKRKSTPKVANKGKSKH

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab