Index 
Search
Download
Help
NUM_00015: C1D protein
ID:

NUM_00015
AC:

15
CL:

NUM
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

C1D protein
OS:

Saccharomyces cerevisiae (Baker's yeast)
P1:

12421302 (2002)
P2:

12421302 (2002), 11801738 (2002)
SS:

GenBenk
SI:

184 AA; 21045 Da; calculated pI: 9.58
SQ:

MEDIEKIKPYVRSFSKALDELKPEIEKLTSKSLDEQLLLLSDERAKLELINRYAYVLSSL
MFANMKVLGVKDMSPILGELKRVKSYMDKAKQYDNRITKSNEKSQAEQEKAKNIISNVLD
GNKNQFEPSISRSNFQGKHTKFENDELAESTTTKIIDSTDHIRKASSKKSKRLDKVGKKK
GGKK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab