Index 
Search
Download
Help
MIX_00432: Alpha crystallin B chain
ID:

MIX_00432
AC:

432
CL:

MIX
DT:

28-JUN-2004 (Rel. 2.2, created)
NA:

Alpha crystallin B chain
Alpha(B)-crystallin
Rosenthal fiber component
Heat-shock protein beta-5
HspB5
GN:

CRYAB
CRYA2
OS:

Homo sapiens (Human)
P1:

12924631 (2003)
P2:

12924631 (2003)
SP:

CRAB_HUMAN, P02511
SS:

SWISSPROT/TrEMBL
SI:

175 AA; 20159 Da; calculated pI: 6.76
SQ:

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW
FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab