Index 
Search
Download
Help
MIX_00429: Nuclear FMRP interacting protein 1
ID:

MIX_00429
AC:

429
CL:

MIX
DT:

28-JUN-2004 (Rel. 2.2, created)
NA:

Nuclear FMRP interacting protein 1
GN:

NUFIP1
OS:

Homo sapiens (Human)
P1:

12941608 (2003)
P2:

12941608 (2003)
SP:

Q9UHK0
SS:

SWISSPROT/TrEMBL
SI:

495 AA; 56368 Da; calculated pI: 9.26
SQ:

MAEPTSDFETPIGWHASPELTPTLGPLSDTAPPRDRWMFWAMLPPPPPPLTSSLPAAGSK
PSSESQPPMEAQSLPGAPPPFDAQILPGAQPPFDAQSPLDSQPQPSGQPWNFHASTSWYW
RQSSDRFPRHQKSFNPAVKNSYYPRKYDAKFTDFSLPPSRKQKKKKRKEPVFHFFCDTCD
RGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNMHAPGMKKIKLDTPEEIARWR
EERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWK
NDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPA
LCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKS
ENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKK
DFFGLDTNSAKSKDV

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab