Index 
Search
Download
Help
MIX_00425: Nucleophosmin
ID:

MIX_00425
AC:

425
CL:

MIX
DT:

28-JUN-2004 (Rel. 2.2, created)
NA:

Nucleophosmin
NPM
Nucleolar phosphoprotein B23
Numatrin
Nucleolar protein NO38
GN:

NPM1
OS:

Rattus norvegicus (Rat)
CT:

fibroblast
P1:

14635188 (2003)
P2:

14635188 (2003)
SP:

NPM_RAT, P13084
SS:

SWISSPROT/TrEMBL
SI:

292 AA; 32560 Da; calculated pI: 4.62
SQ:

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDDEDDEDDEDDEDDDDDDF
DEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPS
SVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab