Index 
Search
Download
Help
MIX_00424: Telomeric repeat binding factor 1
ID:

MIX_00424
AC:

424
CL:

MIX
DT:

28-JUN-2004 (Rel. 2.2, created)
NA:

Telomeric repeat binding factor 1
TTAGGG repeat binding factor 1
NIMA-interacting protein 2
Telomeric protein Pin2/TRF1
GN:

TERF1
TRF1
TRF
PIN2
OS:

Homo sapiens (Human)
P1:

14681297 (2003)
P2:

14681297 (2003)
CC:

binds more tightly to nuclear matrix in immortal cells with increased TRF1 expression
SP:

TRF1_HUMAN, P54274
PD:

1BA5, 1H6O, 1ITY, 1IV6
SS:

SWISSPROT/TrEMBL
SI:

439 AA; 50344 Da; calculated pI: 6.09
SQ:

MAEDVSSAAPSPRRCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEE
EEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQL
RTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQA
IAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKI
KSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDK
QSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATES
RIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVML
KDRWRTMKKLKLISSDSED

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab