Index 
Search
Download
Help
MIX_00419: ISG20 protein
ID:

MIX_00419
AC:

419
CL:

MIX
DT:

28-JUN-2004 (Rel. 2.2, created)
NA:

ISG20 protein
Interferon stimulated gene
20KD
GN:

ISG20
HEM45
OS:

Homo sapiens (Human)
P1:

15064705 (2004)
P2:

15064705 (2004)
SP:

O00441
SS:

SWISSPROT/TrEMBL
SI:

181 AA; 20363 Da; calculated pI: 9.09
SQ:

MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVT
PQHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREA
KLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVS
D

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab