Index 
Search
Download
Help
MIX_00410: Pax transactivation domain interacting protein
ID:

MIX_00410
AC:

410
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Pax transactivation domain interacting protein
GN:

Paxip1
PTIP
OS:

Homo sapiens (Human)
P1:

10908331 (2000)
P2:

10908331 (2000)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

1056 AA; 119216 Da; calculated pI: 6.77
SQ:

MSEPAPEVPEELFREVKYYAVGDIDPQVIQLLKAGKAKEVSYNALASHIISEDGDNPEVG
EAREVFDLPVVKPSWVTLSVQCGALLPVNGFSPESCQIFFGLTACLSQVSSEDRSALWAL
VTFHGGSCQLNLNKKCTHLIVPEPKGEKYERAVKRTSIKIVTPDWVLDCVSEKRRKDEAF
YHPRLIIYEEEEEEEEEGDNEEQDSQNEGSTEKSSVASSAVASPAEQPCSPKPRAEVSKG
ELMFDDSSDSSPEKQERSLNWAPAEAPPLNTAQRRLPQGKGPGLINLCANVPPVPGDILP
PDMRGNLMAPGQNLQNSERSEILGTWSPAVRTLRNITNNADIQQINRPSNVAHILQSLSA
PTKSLEQQVARGQQGHPNASAVLFGQAKGAPETHVLQQHHPPQQPQQQHPALHLQPQIMQ
LQQQQQQQQQQQQQPQPYPQPPSHQFPQQVHQHQFSQQQLQFPQQPLHPQQQLHRPQQQL
QPFQQQHALQQQLHQLQQQQLQHHQLAQLQQQQQQQHNLLQQQQQQQQLQRLQQQQQMQN
QAAHLSQASQALQHQVLPQQPLQLSLQPPPQQQQQQQLFGHDPAVEIPEESFLLGCVFAI
ADYPEQMSDKQLLATWKRIIQAHGGTVDPTFTSRCTHLLCASQVSSMYTQALRERKRCVT
AHWLNTVLKKKKLMPPHRALHFPVAFPPGGKPCSQHIISVTGFVDNDRDDLKLMAYLAGA
KYTGYLCRSNTVLICKEPSGLKYEKAKEWRIPCVNAQWLGDILLGNFEALRQVQYSRYTA
FNMPDPFVPTPHLVLGLLDAWRTPVKVTAELLMGVRLXPKLKPNEVANIQLSSKRARIED
LPPPTKKLTPELTPLVLFTGFEPVQVQQYIKKLYILGGEVAECTKKCTHLIASKVTRTVK
FLTAISVVKHIVTPDWLEECFKRQTFIDEQNYILRDAEAEVLFSFSLEESLKRAHVSPFF
KTKYFYITPGICPSLATMKAIVECAGGKVLAKQPSFRKLMEHKQNKSLSEIILISCENDL
HLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab