Index 
Search
Download
Help
MIX_00399: Peptidyl-prolyl isomerase G
ID:

MIX_00399
AC:

399
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Peptidyl-prolyl isomerase G
cyclophilin G
GN:

PPIG
CYP
CARS-CYP
SRCYP
CASP10
SRCyp
CARS-Cyp
OS:

Homo sapiens (Human)
P1:

9153302 (1997)
P2:

9153302 (1997)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

754 AA; 88708 Da; calculated pI: 10.27
SQ:

MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHY
KSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTN
GSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPK
SKVKKEEKKRHKSSSSSSSSSSDSDSSSDSQSSSDSSDSESATEEKSKKRKKKHRKNSRK
HKKEKKKRKKSKKSASSESEAENLEAQPQSTVRPEEIPPIPENRFLMRKSPPKADEKERK
NRERERERECNPPNSQPASYQRRLLVTRSGRKIKGRGPRRYRTPSRSRSRDRFRRSETPP
HWRQEMQRAQRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKN
EKEKKVKDHKSNSKERDIRRNSEKDDKYKNKVKKRAKSKSRSKSKEKSKSKERDSKHNRN
EEKRMRSRSKGRDHENVKEKEKQSDSKGKDQERSRSKEKSKQLESKSNEHDHSKSKEKDR
RAQSRSRECDITKGKHSYNSRTRERSRSRDRSRRVRSRTHDRDRSRSKEYHRYREQEYRR
RGRSRSRERRTPPGRSRSKDRRRRRRDSRSSEREESQSRNKDKYRNQESKSSHRKENSES
EKRMYSKSRDHNSSNNSREKKADRDQSPFSKIKQSSQDDELKSSMLKNKEDEKIRSSVEK
ENQKSKGQENDHVHEKNKKFDHESSPGTDEDKSG

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab