Index 
Search
Download
Help
MIX_00396: Erythrocyte membrane protein band 4.1
ID:

MIX_00396
AC:

396
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Erythrocyte membrane protein band 4.1
Erythrocyte surface protein band 4.1
GN:

EPB41
EL1
4.1R
HE
OS:

Homo sapiens (Human)
P1:

10189366 (1999)
P2:

10189366 (1999)
CC:

protein found in www.incyte.com-database
SS:

GenBank
SI:

588 AA; 66323 Da; calculated pI: 6.81
SQ:

MHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAK
EIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLG
SYTIQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLEN
AKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFI
KIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFRY
SGRTQAQTRQASALIDRPAPHFERTASKRASRSLDGAAAVDSADRSPRPTSAPAITQGQV
AEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKKKRERLDGENIYIR
HSNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNINGQ
IPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQTVKGGISETRI
EKRIVITGDADIDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEIADE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab