Index 
Search
Download
Help
MIX_00386: Gastrotropin
ID:

MIX_00386
AC:

386
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Gastrotropin
GT
Ileal lipid-binding protein
ILBP
Intestinal 15 kDa protein
I-15P
14 kDa bile acid binding protein
I-BABP
GN:

FABP6
ILLBP
ILBP
OS:

Rattus norvegicus (Rat)
P1:

8232252 (1993)
P2:

8232252 (1993)
CC:

protein found in www.incyte.com-database
SP:

ILBP_RAT, P80020
SS:

SWISSPROT/TrEMBL
SI:

127 AA; 14397 Da; calculated pI: 5.53
SQ:

AFTGKYEFESEKNYDEFMKRLGLPDEVIERGRNFKIITEVQQDGENFTWSQSYSGGNIMS
NKFTIGKECEMQTMGGKKFKATVKMEGGKVVADFPNYHQTSEVVGDKLVEISTIGDVTYE
RVSKRVA

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab