Index 
Search
Download
Help
MIX_00382: Nuclear autoantigen Sp-100
ID:

MIX_00382
AC:

382
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Nuclear autoantigen Sp-100
Speckled 100 kDa
Nuclear dot-associated Sp100 protein
GN:

SP100
OS:

Mus musculus (Mouse)
P1:

10921892 (2000)
P2:

10921892 (2000)
CC:

protein found in www.incyte.com-database
SP:

SP10_MOUSE, O35892
SS:

SWISSPROT/TrEMBL
SI:

482 AA; 54778 Da; calculated pI: 9.01
SQ:

MEGSDGSPRMSTEQENTEMHLIECMLKHFKTQKVAISNAIRSTFPFLESLRDHEFITGKM
YEDLLDSCRSLVPVDKVIYRALEELEKKFDMTVLCELFNEVNMEKYPDLNLIRRSFGCVF
PNELCFQGIDRGNPNSQLSLEQGPGASYSQGSPNGSSLDLSASEGWRSNDRRNSNLMQAN
QTENHQLAESPGHLDSCELQVQLNNRDATPESCSLLPQNEERAVQLNYELQINPCFVQLV
DVKKENSSFSLAGNQQTRARTNQNEDSEIIELSSGDSDNGENFSEATTTVPSQPAPAYSR
KPPTLRRDRGGDTSDTESSIIIRRRKRTGRKKRERLGSYLIRNIKIPMKPSWKTAFLARS
ANPSSQRRRKRGPRIPREENADFGGAELPVVCGNAQGFLDKEKFKQGIYVRSIRGKTGRL
FTPMDFEIEGNCEKAKNWRQTIRCKGWTLRELIQKGVLQDPPRKKKETPRNPRQTRRQVN
AL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab