Index 
Search
Download
Help
MIX_00381: Proteasome subunit alpha type 6
ID:

MIX_00381
AC:

381
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Proteasome subunit alpha type 6
Proteasome iota chain
Macropain iota chain
Multicatalytic endopeptidase complex iota chain
GN:

PSMA6
OS:

Mus musculus (Mouse)
P1:

10852819 (2000)
P2:

10852819 (2000)
CC:

protein found in www.incyte.com-database
SP:

PSA6_MOUSE, Q9QUM9
SS:

SWISSPROT/TrEMBL
SI:

246 AA; 27341 Da; calculated pI: 6.35
SQ:

MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab