Index 
Search
Download
Help
MIX_00379: Dead ringer like-1 protein
ID:

MIX_00379
AC:

379
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Dead ringer like-1 protein
B-cell regulator of IgH transcription
Bright
GN:

DRIL1
DRI1
OS:

Mus musculus (Mouse)
P1:

10921892 (2000)
P2:

10921892 (2000)
CC:

protein found in www.incyte.com-database
SP:

DRI1_MOUSE, Q62431
SS:

SWISSPROT/TrEMBL
SI:

601 AA; 64101 Da; calculated pI: 4.94
SQ:

MKLQAVMETLIQRQQRARQELEARQAPPPPPPEPTGVRARTTMTDEDREPENARMHRTQM
AALAAMRAAAAGLGHPSSPGGSEDGPPISGDEDTAREGTLSSPALHGSVLEGAGHAEGDR
HLMDVGSDDDDTKSKWEEQELEELGEEEEEEEEEDDFEEEEEEEEGLGPPESASLGTAGL
FTRKAPPAQAFRGDGGPRMLSGPERLGPGPAHPSHMASQMPPPDHGDWTFEEQFKQLYEL
DADPKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWR
EITKGLNLPTSITSAAFTLRTQYMKYLYPYECERRGLSSPNELQAAIDSNRREGRRQSFG
GSLFAYSPSGAHSMLPSPKLPVTPLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPV
SLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESTEPPEKKMALVADEQQRLMQ
RAVQQSFLAMTAQLPMNIRINSQASESRQDSAVSLTSANGSNSISMSVEMNGIVYTGVLF
AQPPPPTAPSAPGKGGVSSIGTNTTTGSRTGASGSTVSGGQVGLPGVSTPTMSSTSNNSL
P

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab