Index 
Search
Download
Help
MIX_00372: Protein-glutamine gamma-glutamyltransferase
ID:

MIX_00372
AC:

372
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Protein-glutamine gamma-glutamyltransferase
Tissue transglutaminase
TGase C
TGC
TG(C)
Tranglutaminase 2
TGase-H
GN:

TGM2
OS:

Homo sapiens (Human)
P1:

9575137 (1991)
P2:

9575137 (1991)
CC:

protein found in www.incyte.com-database
SP:

TGM2_HUMAN, P21980
PD:

1FAU, 1KV3
SS:

SWISSPROT/TrEMBL
SI:

687 AA; 77241 Da; calculated pI: 5.11
SQ:

MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab