Index 
Search
Download
Help
MIX_00365: Nicotinamide mononucleotide adenylyltransferase 1
ID:

MIX_00365
AC:

365
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Nicotinamide mononucleotide adenylyltransferase 1
NMN adenylyltransferase 1
GN:

NMNAT1
NMNAT
OS:

Homo sapiens (Human)
P1:

1282798 (1992)
P2:

1282798 (1992)
CC:

protein found in www.incyte.com-database
SP:

NMA1_HUMAN, Q9HAN9
PD:

1GZU, 1KKU, 1KQN, 1KQO, 1KR2
SS:

SWISSPROT/TrEMBL
SI:

279 AA; 31896 Da; calculated pI: 8.98
SQ:

MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGL
IPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTL
ERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVAN
YGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLV
PDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab