Index 
Search
Download
Help
MIX_00362: Metaphase chromosomal protein 1
ID:

MIX_00362
AC:

362
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Metaphase chromosomal protein 1
33 kDa metaphase chromosomal protein
GN:

MCP1
MCP33
OS:

Homo sapiens (Human)
P1:

11196133 (2000)
P2:

11196133 (2000)
CC:

protein found in www.incyte.com-database
SP:

MC33_HUMAN, Q14805
SS:

SWISSPROT/TrEMBL
SI:

290 AA; 32944 Da; calculated pI: 4.84
SQ:

MMVNHNFTSFTSNERAVVKLNEVMQAALVNSDDRDWRYFVMLVPVLYDMQQFLVKEGSMN
ERFVAQAPKFDINFWRMIITVMAINFFKWQGKDVAELMKTSSAIDDLQFKFLQVDDKDDH
FNLPVIAETFRGLSPKMKPLKGADSVVALEPKLTEAQIQAELEFADKRLAQFKAASVKDV
VSDNVVNMLRGFHEGLATEYQATHDLWQPAMFNALATDKLFNYWSPAWDNLDGIGGEVKS
YLTFLSQKQDISGLSEFVTGTAGIDRYIDVAALNHLLEQMPEDVLAERAL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab