Index 
Search
Download
Help
MIX_00361: Fanconi anemia group C protein
ID:

MIX_00361
AC:

361
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Fanconi anemia group C protein
FACC protein
GN:

FANCC
FAC
FACC
OS:

Homo sapiens (Human)
P1:

11297559 (2001)
P2:

11297559 (2001)
CC:

protein found in www.incyte.com-database
SP:

FACC_HUMAN, Q00597
SS:

SWISSPROT/TrEMBL
SI:

558 AA; 63355 Da; calculated pI: 5.77
SQ:

MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTV
IERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINKEPQNSGQSKLNSWIQGVLSH
ILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERV
ASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEAVNEAILLKKISLPMSAVV
CLWLRHLPSLEKAMLHLFEKLISSERNCLRRIECFIKDSSLPQAACHPAIFRVVDEMFRC
ALLETDGALEIIATIQVFTQCFVEALEKASKQLRFALKTYFPYTSPSLAMVLLQDPQDIP
RGHWLQTLKHISELLREAVEDQTHGSCGGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPT
ALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGHLLAMSRSSSLSAQDLQTVAGQGTDTDLR
APAQQLIRHLLLNFLLWAPGGHTIAWDVITLMAHTAEITHEIIGFLDQTLYRWNRLGIES
PRSEKLARELLKELRTQV

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab