Index 
Search
Download
Help
MIX_00356: Eosinophil lysophospholipase
ID:

MIX_00356
AC:

356
CL:

MIX
DT:

15-SEP-2003 (Rel. 2.1, created)
NA:

Eosinophil lysophospholipase
Charcot-Leyden crystal protein
Lysolecithin acylhydrolase
CLC
Galactin-10
GN:

CLC
OS:

Homo sapiens (Human)
P1:

1987770 (1991)
P2:

1987770 (1991)
CC:

protein found in www.incyte.com-database
SP:

LPPL_HUMAN, Q05315
PD:

1G86, 1HDK, 1LCL, 1QKQ
SS:

SWISSPROT/TrEMBL
SI:

141 AA; 16331 Da; calculated pI: 6.80
SQ:

SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRR
VVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAV
KMVQVWRDISLTKFNVSYLKR

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab