Index 
Search
Download
Help
MIX_00353: SCAF-8
ID:

MIX_00353
AC:

353
CL:

MIX
DT:

03-SEP-2003
NA:

SCAF-8
SR-like CTD associated factor 8
RA 8 (??)
GN:

SCAF8
P1:

9528809 (1998)
P2:

9528809 (1998)
CC:

SCAF8 binds to phosphorylated CTD-domain
SP:

Q63623
SS:

SWISSPROT/TrEMBL
SI:

1268 AA; 139503 Da; calculated pI: 8.49
SQ:

MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKV
PGLYVIDSIVRQSRHQVGQEKDVCAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKN
NVFKSEIIQPLLDMAAGIPPPVVTPVLASTTVAMSNTPGTPVTPVTPANVVQGLPDPWVS
QITNTDTLAAVAQILQSPQGQQLQQLIQTLQIQQQKPQPSILQALDAGLVVQLQALTAQL
TAAAAAANTLTPLDQGVSFNKKLMDRFDFGEDSEHSEESKKEIPTPQLSHVSESVNNSIF
HQIAEQLQQQNLEQLRQQLLEQQQPQKVTPQDSQEGAFGSEHSASPSQGSSQQHFLEPEA
NLDDSIDIQQQDMDIDEGQDVVEEEIFEPEAKKVAVRSRSRTHSRSRSRSPRKRRSRSRS
GSRKRKHRKRSRSRSRERKRKSSRSYSSERRAREREKERQKKGLPPVRSKTLSVCSTTLW
VGQVDKKATQQDLTNLFEEFGQIESINMIPPRGCAYVCMVHRQDSFRALQKLSSGSYKIG
SKVIKIAWALNKGVKTEYKQFWDVDLGVTYIPWEKVKVDDLDGFAEGGMIDQETVNAEWE
TVKTSEPVKETVQTTQSPAAVEKETVVTTQSEVFPPPVTMLQIPVAPTVPAVSLVPPAFP
VSMPVPPPGFSPIPPPPFLRASFNPSQPPPGFMPPPVPPPVVPPPAIPPVVPTSLVQPPL
SMTPETVKDVGFGSLVLPGGSVAGNLAPSTLPAGNVFNPPSKAEPEEKVPHLTEHQIPSG
ENTRPVIPSDIPSSAPMLAQPPGASNTSGILCVQRPNVSSNSEILGVRPANVSNSAAIMG
AQPPNMLNNSGILGIQPPNVSSGSGLLGVLPPNLPNNSGLVGLQPPNVTNPAGLLGTQPP
IGPQNLPPLTIPAQRMPALPMLDIRPGLIAQAPGPRFPLLQPGIPPQRGIPPPSVLDAAL
HPPPRGPFPPGDLFSQPERPFLAPGRPNIDSVPNPDKRIPLGNDNIQQEGDRDYRFPPIE
TREGINRPPPVDVRDVVGRPIDPREGPGRPPLDGRDHFGRPPVDMRETLVRPGLDHLGRR
DHFGFPPEKPWGPRDFDEREHRVLPVFGGPKGLHEERGRFRAGNYRFDPRSGPWNRGFGQ
EVHRDFDDRRRPWERQRDRDDRDFDFCREINGNRLGRDRIQNTWVPPPHARVFDYFEGAT
SQRKGENVPQVNGGNTERHAPPPPLPVQKDPELYEKLASSGDADKEESGTAAGVESEAVV
ESTETEGT

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab