Index 
Search
Download
Help
MIX_00350: Glucocorticoid receptor
ID:

MIX_00350
AC:

350
CL:

MIX
DT:

30-AUG-2003
NA:

Glucocorticoid receptor
GR
GN:

NR3C1
GRL
GRL1
OS:

Mus musculus (Mouse)
P1:

10848625 (2007)
P2:

1659997 (1991), 2717578 (1989), 3528149 (1962), 3729932 (1986), 8628265 (2001), 10813393 (2000), 9353307 (1997), 9731709 (1998), 12024025 (2002), 10848625 (2007)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

GCR_MOUSE, P06537
SS:

SWISSPROT/TrEMBL
SI:

783 AA; 86052 Da; calculated pI: 5.99
SQ:

MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSASSPSVAAASQADSKQQ
RILLDFSKGSASNAQQQQQQQQPQPDLSKAVSLSMGLYMGETETKVMGNDLGYPQQGQLG
LSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEKEFPQTHSDPSSEQQNRK
SQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPWRSDLLIDENLLSPLAGED
DPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVALPQVKTEKDDFIELCTPGVI
KQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPVFN
VIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSNGYSSPGMRPDVSSPPSSSSTA
TGPPPKLCLVCSDEASVCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNC
PACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENANKTIVPAALPQLTPTLVS
LLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMT
LLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLIINEQRMTLPCMYDQCKHMLFISTELQ
RLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQR
FYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKYSNGNIKKLLF
HQK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab