Index 
Search
Download
Help
MIX_00337: Calcium/calmodulin-dependent protein kinase type IV catalytic chain
ID:

MIX_00337
AC:

337
CL:

MIX
DT:

26-MAY-2003
NA:

Calcium/calmodulin-dependent protein kinase type IV catalytic chain
CAM kinase-GR
CaMK IV
Calspermin
GN:

CAMK4
OS:

Mus musculus (Mouse)
CT:

testis
P1:

10932193 (2000)
P2:

10932193 (2000), 10713118 (2000), 11486043 (2001)
SP:

KCC4_MOUSE, P08414
SS:

SWISSPROT/TrEMBL
SI:

469 AA; 52568 Da; calculated pI: 4.83
SQ:

MLKVTVPSCPSSPCSSVTASTENLVPDYWIDGSNRDPLGDFFEVESELGRGATSIVYRCK
QKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGG
ELFDRIVEKGYYSERDARDAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIA
DFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDE
RGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWVTGKA
ANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHTSIQENHKASSDPPSTQD
AKDSTDLLGKKMQEEDQEEDQVEAEASADEMRKLQSEEVEKDAGVKEEETSSMVPQDPED
ELETDDPEMKRDSEEKLKSVEEEMDPMTEEEAPDAGLGVPQQDAIQPEY

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab